DPCstruct | MC50651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 22.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5WPF5 | 58-145 | FVVVDDPFFTALPRIRRVEGKENSEITWLVYQLNRNESGVGYAMSDPKVIFTLWDDVLTALREGEAPQQSEVLAEVAARIPQLRSFDT |
| A0A2E1VXB3 | 154-252 | QLVSKGAICSRWDTKIVAVVQEDLFEKFQEHAEFTEARIDQANVVFLTYQFTRSAADDRWGLQFSRVFPTTHGSLMTASLYERVPAR… |
| A0A349BQW3 | 35-129 | None |
| A0A1V4M7S9 | 284-375 | None |
| A0A1C0SI78 | 7-104 | None |
| A0A1M6KH37 | 357-450 | None |
| A0A2V8QXD1 | 3-85 | None |
| A0A369QCI6 | 64-164 | None |
| Q3APT7 | 409-496 | None |
| A0A419KBD5 | 101-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.