DPCstruct | MC50644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 77 ± 17 aa |
| Standard deviation of domain lengths | 16.81 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05741 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EK09 | 1-52 | CAFCRNNHETKTMYMSHILKDANGDVVCPILSKYVCPICSATGKAAHTTRYC |
| A0A087YRK6 | 9-90 | KQEPKICVFCRNNGAPEEVFGSHVLKTPDGRVVCPILRAYTCPLCSANGDNAHTIKYCPLSKDQPSQRPLKGGRAVGGKRMK |
| A0A3S0ZZQ8 | 429-506 | None |
| A0A821UVL0 | 186-264 | None |
| A0A821XYN7 | 433-505 | None |
| A0A1S3IMS3 | 87-158 | None |
| A0A250KA99 | 89-175 | None |
| A0A183STP8 | 46-110 | None |
| A0A226F0R8 | 216-282 | None |
| A0A6I8PB54 | 56-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.