DPCstruct | MC5064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 139 ± 13 aa |
| Standard deviation of domain lengths | 12.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14078 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T7XBG3 | 21-151 | AAGTWGYGQFDSDHALDFAADWAEAGTVESIREALTFAAGQAYLGAPDAEKALVAAEVVAASLGKPNDKLPAELATWISRQPPQELR… |
| A0A2S5VMV6 | 51-185 | AMGTWSGQPFGSDSASDWAYDLAEAPDWSIVREALTTVAGETEVDSDDAVIAIAAAEVVAHGLDRPTQTDAYTESVASFAQRAGRPD… |
| A0A1H2DDF0 | 1-151 | None |
| A0A5C8JT52 | 25-151 | None |
| A0A0B5S0N9 | 1-129 | None |
| A0A5C7YIK0 | 210-342 | None |
| A0A7X1AY90 | 1-149 | None |
| A0A7D7VFN1 | 1-149 | None |
| A0A5P2C6Q2 | 1-149 | None |
| A0A6H0ALG2 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.