DPCstruct | MC50638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Standard deviation of domain lengths | 13.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 62.87 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | PF00177- PF00223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067JLK3 | 17-117 | IFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWFFLCAHFVWAFSLMFLFSGRGYWQELIESIVWVHNKLTVAPATQPKALSIIQGR… |
| A0A0R8RYU6 | 97-201 | NFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSI… |
| A0A2G2XC02 | 293-383 | None |
| A0A6S7PQ45 | 175-286 | None |
| A0A7J9LF24 | 72-176 | None |
| U5D1H4 | 22-134 | None |
| A0A3B6PKD4 | 550-658 | None |
| A0A368PEM4 | 151-258 | None |
| A0A5D2K9K1 | 35-127 | None |
| A0A2G3B988 | 140-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.