DPCstruct | MC50637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 74 ± 17 aa |
| Standard deviation of domain lengths | 16.54 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 54.86 |
| Pfam Score | 98.91 |
| Assigned Pfam label(s) | CL0167- CL0426 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6T670 | 1-64 | MGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTAGGNQ |
| A0A0D8XND6 | 1-86 | MTKGTQAFGKKHVKSHTLCKRCGRSSFHIQKKRCASCGYPDAKKRKYNWGAKSIRRRTTGTGRMRHLRKVHRRFRNGFREGTTPKP |
| A0A816W358 | 133-215 | None |
| G7XFS6 | 1-71 | None |
| A0A2R6ATB3 | 2-43 | None |
| A0A453MTI0 | 1-57 | None |
| A0A4X3PPB7 | 301-427 | None |
| A0A834ZPI5 | 29-101 | None |
| A0A445B2M8 | 3-42 | None |
| U7PRX1 | 279-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.