DPCstruct | MC50631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 178 ± 24 aa |
| Standard deviation of domain lengths | 23.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P1ASE2 | 1-194 | MRGRDIISTVAVLIALQAHKISSTLNRKLEAMRENEDLMKMEEFFGVKAERKLEKMLTSAKHKPAPWNGPSWLTMNDSINFCYLSGE… |
| D0RLV7 | 1-135 | MEMTLKDLPTQGVFTPAPWPAPYWPTYQDSINVVWSQGQPSPAEKYAKAFGLDVKEFMDKVSKDNGVDSGSKRTKCSSDNDCASRTD… |
| A0A833TIC7 | 234-466 | None |
| A0A2P4YT18 | 3-185 | None |
| K3WTJ2 | 25-189 | None |
| K3WTJ1 | 80-252 | None |
| A0A6A3KYK5 | 72-241 | None |
| A0A2D4BKB0 | 58-236 | None |
| A0A2D4CDP0 | 201-372 | None |
| A0A2D4C7P4 | 70-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.