DPCstruct | MC5063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0174 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C4WU84 | 13-95 | DRGYGMMREILEHAQRAGKLRADVTLPDMAFVVWGVAATVRATHKVAPGAWRRHLALALDGLRATAAQPLPAPPMSTEQARAA |
| A0A8B0KRA9 | 16-98 | ARIQRGITRLFARARSAGAIRADVTAEDLLFITLANAGVVAATRDVAPDAWRRNVGLYLDAFRPVHTTELPAPPLTVRQLADV |
| A0A286PGZ7 | 44-129 | None |
| A0A5R8MPG9 | 1-81 | None |
| A0A6G3VQH9 | 2-77 | None |
| A0A7K3DV72 | 10-94 | None |
| A0A4R1DJZ7 | 14-111 | None |
| A0A4D4LQC1 | 5-91 | None |
| D3D699 | 85-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.