DPCstruct | MC50624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 82 ± 11 aa |
| Standard deviation of domain lengths | 11.32 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 71.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y6ZVP0 | 1-95 | MAEWDGKYIYPYAEHGKKSEQVKKVTVSIPINVLKVLTDERTRRQINNLRHATNSELLCEAFVHAFTGQPLPDDDDLRKDNPNRIPA… |
| A0A841KGA0 | 3-77 | GNKYIKPYVDHGKKAGAVRKVTVSIPLHVLRLLSDERTRRQVNNLRHATNSDLLVEAFLHAFTGQPLPTDEELRR |
| A0A376FG64 | 1-112 | None |
| A0A0P8YW18 | 1-82 | None |
| B7MI70 | 47-127 | None |
| A0A316I7K0 | 3-77 | None |
| A0A522JJ13 | 3-77 | None |
| A0A4R2HYX0 | 5-78 | None |
| A0A3S4IL98 | 1-75 | None |
| A0A3A1Y616 | 3-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.