DPCstruct | MC50623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 129 |
|---|---|
| Mean domain length (aa) | 195 ± 33 aa |
| Standard deviation of domain lengths | 33.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.35 |
| Pfam Score | 70.09 |
| Assigned Pfam label(s) | PF02662- CL0344- PF02754 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432Q5F5 | 266-462 | VITWNQDICQYSGRLGIGCDVCVSACEHQALTRDHNGITIHHTHCTECGDCLAGCPTGALQYTRFTDVEFIEYFSNITLQPGTTIVI… |
| A0A7C4ASQ1 | 2-202 | AHIDPSKCTACGLCARVCPYHAIEGGKEQGFYRVIEAACQGCGACVPECRFGAIEQAHFTEEQIVAQIDQALEKDPHTKIIAFACNW… |
| A0A136NBT9 | 18-174 | None |
| A0A7C1EAP6 | 1-136 | None |
| N0BMD1 | 8-197 | None |
| A0A0C2V5R4 | 206-388 | None |
| A0A447TY35 | 8-161 | None |
| A0A7Y2IUC4 | 35-229 | None |
| A0A523ARK2 | 157-366 | None |
| A0A523AYC1 | 4-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.