DPCstruct | MC5062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 94 ± 12 aa |
| Standard deviation of domain lengths | 11.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C4WN90 | 6-99 | DMSGAPDSLRERLDEYRRIFEHALAGRERTGGGIRFRFRARPGVEAWVRDLAARERACCAFFAFEVTAQGDEVLWDASVPDDAAARA… |
| A0A2E1AGJ9 | 9-104 | EAIPIACDPHALSAQQQERWMIVGKQMYSAIEEIRELPGGYAFRLPGTAEMLMIIAEDLTMERLCCPFLHFTLDVERTGEPFWLSFT… |
| A0A841CXE0 | 175-268 | None |
| A0A5C8Q8M1 | 90-176 | None |
| A0A521QG10 | 72-172 | None |
| A0A7W1A8F4 | 108-230 | None |
| A0A7S8FAT1 | 23-133 | None |
| A0A7W8QL93 | 165-270 | None |
| A0A1H3QSA2 | 1-69 | None |
| A0A2L1S9N2 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.