DPCstruct | MC50614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 86 ± 11 aa |
| Standard deviation of domain lengths | 10.90 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.44 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0237- CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7PEP9 | 20-102 | ASGSDLSETSVSSLPTRGLESLEVLEVRDTPTLREFPSVYHFRFIRAAHLTYPYHCCAFQFPETHNPEEHSRCVLRFISAEHE |
| A0A6L5CMA0 | 32-109 | DLSETSISHIPTAGLKELEILRLEDTTKLKVIPSIYNFEYLTAAYLNYPYHCCAFQYPAKHDPEEFAKHELTVKLNLH |
| A0A1S3MUK1 | 47-135 | None |
| A0A368F5P8 | 86-187 | None |
| A0A1D2NAR0 | 2-86 | None |
| A0A7R9ED22 | 40-153 | None |
| A0A7R9QV12 | 1-76 | None |
| A0A7R9A4I9 | 2-74 | None |
| A0A1Y1KBP0 | 260-335 | None |
| A0A667XWI8 | 203-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.