DPCstruct | MC50612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 151 |
|---|---|
| Mean domain length (aa) | 303 ± 86 aa |
| Standard deviation of domain lengths | 85.81 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.97 |
| Pfam Score | 64.78 |
| Assigned Pfam label(s) | CL0369- CL0599- CL0158- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7PD35 | 115-398 | MVNNSRKKGRRVRMFYSTPLCYLASLHAANQSWPVFRGDLFPYADNPNRAWTGFYTNNPNRAWTGFYTSRPNLKGFARYANGFLQAG… |
| R5RM91 | 3-273 | TSREFFETLDKNVTGKKYLPTWVGELYLEYHRGTYTSMARNKKYNRRSEFAYQNEEMYAILDQQLCGGSYPEKELKEGWEVILRNQF… |
| A0A2U3L2G6 | 82-329 | None |
| A0A6P8CAY3 | 178-546 | None |
| A0A654HKJ7 | 100-341 | None |
| A0A821ES73 | 118-485 | None |
| A0A0N5D6K0 | 441-728 | None |
| A0A7J9RKU6 | 457-782 | None |
| A0A183MFY9 | 202-718 | None |
| A0A821RDM1 | 164-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.