DPCstruct | MC5061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 196 ± 28 aa |
| Standard deviation of domain lengths | 27.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.60 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0291- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1UWI4 | 48-214 | VAICYAHWEGGVKFSASKYMEFISLRKMSYDSLNPQFRRNYFLPRLSTIAQSGISLSERCRLIDDIISSGNKRFSRINCELIDTKSN… |
| A0A5C4VXF5 | 2-180 | LVMLYAHLEGFTKFALEQYALTINDAKVPVSRLKPQLLAACLLDCFKRYRSSEASDPYDPSANRARQVLKDAELLQEISTLQNRVAV… |
| A0A6N8I3P1 | 1-187 | None |
| A0A064C562 | 1-246 | None |
| A0A844BCY5 | 3-231 | None |
| A0A1E4QJL1 | 1-148 | None |
| A0A450TNC5 | 4-206 | None |
| A0A009QPE3 | 50-249 | None |
| A0A4Q5NIX8 | 48-209 | None |
| A0A0A7FWD3 | 2-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.