DPCstruct | MC50609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 9.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 48.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04889 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7PBX0 | 2-79 | QEAERKVQEERIRMENILSGNPLLNSTKAEFKVKRRWDDDVVFKNCAKGDLEGSKERHFINDTLRSEFHKKFMEKYIK |
| A0A6A6KNF6 | 18-92 | QDQQRAAEELKAKEEQLLRGNPLLNNPTSFNVKRRWDDDVVFKNQARGETKTPKRFINDTIRNDFHRKFLQKYMK |
| A0A0B1SCK2 | 1-73 | None |
| A0A167E9P0 | 237-318 | None |
| A0A3R6Z2Q8 | 111-215 | None |
| A0A446UIE6 | 116-192 | None |
| A0A7D8V0E2 | 171-260 | None |
| A0A6A0AKX8 | 1-69 | None |
| A0A3P6RF99 | 1-72 | None |
| A0A7S0V5G0 | 58-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.