DPCstruct | MC50608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 110 ± 12 aa |
| Standard deviation of domain lengths | 11.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7P4Z1 | 5-112 | IDEFPPPDLEPGKRLDIYGRSFLIYDCDDFTKNFYRETLGVTHFNVVDVDVREEERPKQRIPPYNGFGSPEDTLQSVLRITPRRMRK… |
| A0A7S4KFM6 | 360-454 | KDLIVGNTIEIFGRDMFLYDCDSFTREYYLHQYGVEQPANQVEPETHVEFPSMPLPPYNGFGSEHDSLASYFNLIPKPRKYDRTKQA… |
| A0A183RDW2 | 52-176 | None |
| A0A815II70 | 1-89 | None |
| A0A7S3INP8 | 1-112 | None |
| A0A670YWT8 | 204-293 | None |
| A0A6A4VAS8 | 1-107 | None |
| A0A2K5MYB9 | 230-344 | None |
| A0A212BZX6 | 218-320 | None |
| A0A821U4K9 | 124-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.