DPCstruct | MC50606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 297 ± 36 aa |
| Standard deviation of domain lengths | 36.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0YJF2 | 1-333 | MVEPLLGVPPRIDLGQGVEIPLYVDGIQQRGYLKSCDNPSRLGKGCISGSVLQRYEGRTRDGEPLPSVVWVSFGRNSSFAYRGKVHV… |
| A0A1H8R5X9 | 5-236 | SRLLNLSYGKTQISAMCRREQLRDPNSKFFDEVDIVAHNVDTGDTCWFHAEGKPGQKTGFDASRVPPPNEKAPPPQRIAAGQFWWAP… |
| A0A1E4ZTD6 | 35-292 | None |
| A0A3M1TTJ5 | 176-506 | None |
| A0A2U0YWX3 | 1-324 | None |
| A0A7W1B9K8 | 186-474 | None |
| A0A2E8I5A1 | 162-440 | None |
| A0A2A5HNH4 | 2-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.