DPCstruct | MC50601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 161 |
|---|---|
| Mean domain length (aa) | 158 ± 33 aa |
| Standard deviation of domain lengths | 33.42 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.65 |
| Pfam Score | 92.18 |
| Assigned Pfam label(s) | CL0339- CL0116- CL0062- PF04264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5Z312 | 10-153 | MSYTYGRFNDVDGSIVVGDAPSDSAFSFTVRTKSVDTHNKDRDKHLRNPDFFNAVQYPTITFKSTGIHAHGDSLHVTGDMTMHGVTR… |
| A0A6C0NHW2 | 4-114 | VDTNHAERDKHIRSASFLNATKFPEATFVSKEVKKNGEGLDITGDLTLNGVMHPVTLDAKLIGKGDDPWGGKRAGFEATGNIHLKDF… |
| A0A160VLK7 | 5-91 | None |
| A0A3L7W721 | 181-369 | None |
| A0A357YJP2 | 7-160 | None |
| A0A1G3H049 | 2-183 | None |
| A0A0L9VIS8 | 16-239 | None |
| A0A7Y4ZNN5 | 48-232 | None |
| A0A254TK91 | 5-174 | None |
| A0A5C8J191 | 8-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.