DPCstruct | MC5060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 8.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9FBH9 | 51-123 | SLPCVVCGRTLQNVFEGSVNQPSGGLAFTSGGHYGSTVYDPFNDESLELNICDECLTKASSTLRILRYKRIPQ |
| A0A5C4V5W8 | 9-81 | LPCLACGKPLTSALPGACINQPSGATTFTTTGHYGSTVFDPMDGSRLDVNVCDDCLTARRDRVLHIAHDGTLQ |
| A0A7L7VYS1 | 1-76 | None |
| A0A2D8R3C5 | 1-96 | None |
| A0A4Q7ZLG4 | 109-197 | None |
| B8HIS4 | 2-89 | None |
| A0A2M9HTH2 | 1-92 | None |
| A0A1F6D9X2 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.