DPCstruct | MC506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 148 ± 23 aa |
| Standard deviation of domain lengths | 22.55 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 66.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6LRR5 | 2-131 | KILESKIHSLETFLRSRRNKRRGHAVPLTLTLKEDYVHIRAKRGQATNSQSLAERLGRKKISERMKLLQDLVPECSKIIGKAIMLDE… |
| A0A453M4N0 | 11-169 | PASEDDSASARPVSTSGGGGQDLTDAEAKRFKANKSSDENGSFRKDAEADSRNASKAVDQNPPPPKQDFIHVRARRGQATDSHSLAE… |
| A0A2K1ITE9 | 27-156 | None |
| A0A2K1J068 | 308-461 | None |
| A0A2G3APS4 | 2-149 | None |
| A0A1P8B161 | 107-263 | None |
| A0A4Y1QQN2 | 2-152 | None |
| A0A4S8IGM5 | 51-218 | None |
| A2Z2Z7 | 5-139 | None |
| A0A7N0UM46 | 13-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.