DPCstruct | MC50595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 109 ± 20 aa |
| Standard deviation of domain lengths | 20.03 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13330 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3IUA3 | 13-122 | ALNSIQAHYWTTWYDRDNPSGNGDYETLYEQKKLGYVCGGCKPIGAECRVRGSVYTFTRWYGTAPDKLSIHCLPTKGLACVNSQQPD… |
| S4RSR4 | 2-87 | YWTRWYDRDDPSGNGDYETLQQLRQEYPGEICLSPLAIEAMTLDWIPADQTGQVTVNGTTVGFYCVNIRQVDNQCLDYQVRFLCQA |
| A0A3B4AAX2 | 55-193 | None |
| A0A813SVC6 | 659-745 | None |
| A0A4W5PHQ9 | 20-109 | None |
| A0A3Q3WNY9 | 66-147 | None |
| A0A1S3IHY4 | 657-773 | None |
| A0A1S3ISI2 | 54-148 | None |
| A0A1S3IV18 | 53-152 | None |
| A0A4W6FME7 | 24-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.