DPCstruct | MC50594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 324 ± 69 aa |
| Standard deviation of domain lengths | 68.78 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07767 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N3ZYN7 | 2-191 | KDERHLERVTTGMFSKVTESERDNNWLVEMSQGLQKEEAENSDNEYKSINPPVKNKKKDLKQRRKQREHSKLLSAIQMAKKAKKKIT… |
| A0A1S3ITV7 | 28-367 | VIPRNIKSNNIKKLSERRRIKLEQNILNSREREGKVHRKKAAEVAKIRRITRNKLPNTGYDLWAEDNVNSSVKEVAEYHEKYTKKTK… |
| A0A0K3ANY4 | 72-437 | None |
| A0BJ49 | 51-316 | None |
| A0A5B7FAP2 | 9-440 | None |
| A0A3Q0IXV0 | 206-558 | None |
| A0A0V0QLT9 | 11-405 | None |
| A0A0D3C8I0 | 1-314 | None |
| B6AD11 | 3-378 | None |
| A0A0D0U255 | 42-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.