DPCstruct | MC50593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 141 ± 24 aa |
| Standard deviation of domain lengths | 23.73 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3IT37 | 1-170 | MIFYIFHQQIQQTVLDTLTPDDIRVLIATVDEDSRKGGFERVFPTAKSSKYLKFFEQPRYYNLLLNQWVQRYNKMEARGVALLDSFC… |
| T1JAJ5 | 183-290 | MERHEYLLTVLANPTADDIRQLVLAEDERSRAGQYICVYPTHHTNRYHKYFDRARYYNHLFDAWETRYHSCRDDGIQKLIEACKQGL… |
| A0A7J7KL05 | 126-280 | None |
| A0A7J7IXU6 | 1-155 | None |
| A0A1Y1KUU5 | 346-476 | None |
| A0A2S2R1C1 | 58-230 | None |
| A0A146MB87 | 845-975 | None |
| A0A7R9HAF8 | 177-316 | None |
| Q95TA0 | 11-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.