DPCstruct | MC5059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 182 ± 27 aa |
| Standard deviation of domain lengths | 27.00 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842M7S8 | 13-190 | LNKELSSKIKLIKKLQEKYNKEKKLRENLERNINSLLEMKEFEHKGEKLPVKIVKSFTKEGIKEACHQWKIKKDDVILLYSAKGGGS… |
| A0A812A1L9 | 4-142 | LEMTGYATPVKILRSFTKDSIQQTKDANGIKKGDVILIMDASGGGTATADILAQLQIKAVATYNEMSHEAEQQLFINNIPVFSAVQL… |
| A0A1V4YVZ6 | 5-156 | None |
| A0A662UHU8 | 460-682 | None |
| A0A7K3YTX3 | 456-645 | None |
| A0A2I0PNI1 | 299-507 | None |
| A0A843DN69 | 16-187 | None |
| A0A7C4LG99 | 26-260 | None |
| A0A843IW85 | 2-165 | None |
| A0A166A836 | 343-505 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.