DPCstruct | MC5058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 164 ± 39 aa |
| Standard deviation of domain lengths | 39.31 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 91.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.90 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF21436- PF18527 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5TYX8 | 64-231 | NSSPEALMKAVRSPVDSPGDPVYLLFTADMIGKYGAFSKIGSWNLDKGGSNPKGYQNLSCQSIADNVMTCGNTKIDLNQGRINQRVP… |
| A0A842M235 | 33-185 | KELLSYTHPTNKPFIILTCDDMILAGKWCVYYGFWDFNKSQGYNYTYSVGLSNDTGQIRHYANNVTLNLEDGGLWQNKKPYNTIIKN… |
| A0A1G3U9F8 | 41-223 | None |
| A0A432RYM7 | 13-171 | None |
| A0A842L1D2 | 10-134 | None |
| A0A846QER4 | 8-136 | None |
| A0A0C2Z796 | 2-116 | None |
| A0A525CCF1 | 780-940 | None |
| A0A843GA49 | 1-183 | None |
| C5F1E0 | 155-413 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.