DPCstruct | MC50577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 55 ± 2 aa |
| Standard deviation of domain lengths | 2.36 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0233 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498I462 | 1-55 | MKLQIKVDDSTGKIDDACFKTFGCGSAIASSSIATEWVKGKQLEEVLTIKNTEIA |
| X1RYN0 | 1-54 | MAFYIKVDNNRISDVKYKTFGCGAAIAVSSMVSEMAKGKTLEEAKKITPALVAK |
| A0A6S7NFJ2 | 52-110 | None |
| A0A2I6QLM6 | 1-54 | None |
| A0A7J7AI40 | 12-65 | None |
| A0A396IWL1 | 1-51 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.