DPCstruct | MC50575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 777 |
|---|---|
| Mean domain length (aa) | 143 ± 26 aa |
| Standard deviation of domain lengths | 26.42 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.77 |
| Pfam Score | 97.77 |
| Assigned Pfam label(s) | CL0052- CL0126- PF13382- CL0105- CL0507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A827F8V2 | 42-172 | GQGQMLSAGCADLVLTNALIIDYWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGVSTEIIAAEGRIVTAGGVDTHIHWICPQQ… |
| X1RT83 | 24-163 | APASGQEKTPKPQILFINCNVFDGKADKLATNRRVLVEGNLIKTIGDKGLKGAKHAKVIDCGGRTLMPGLIDSHSHFNVEIDGGLKE… |
| A0A2A4I5V5 | 370-533 | None |
| A0A2J8ABX4 | 8-161 | None |
| A0A511NDW4 | 35-170 | None |
| A0A3D1Q9B6 | 18-101 | None |
| B5IKJ1 | 7-149 | None |
| G8S4B6 | 61-198 | None |
| D4KYQ0 | 2-127 | None |
| A0A1H4E3I6 | 7-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.