DPCstruct | MC5057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 89 ± 16 aa |
| Standard deviation of domain lengths | 15.60 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.63 |
| Pfam Score | 93.43 |
| Assigned Pfam label(s) | PF04561- CL0410- PF04563- PF04565- PF04566 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183NPJ2 | 22-97 | LSGQSTGLSVPADNVNFLRFAAQFRAVHRGAFFTEMRTTSVRRLLPEAWGFFCPVHTPDGAPCGLLNHLAEPVEVN |
| A0A842KV35 | 10-89 | GISQLLDRTSYMGTLSHLRRVVSPLSRSQPHFEARDLHPTQFGKICPNETPEGPNCGLVKNLALMVRISEGADPDEIKDV |
| U5DGA1 | 284-366 | None |
| A0A244C0W4 | 386-454 | None |
| G6C2T1 | 471-541 | None |
| A0A7S0MES3 | 26-158 | None |
| A0A445DHU6 | 18-117 | None |
| A0A1P8BFS9 | 444-530 | None |
| A0A2A2KTH8 | 275-391 | None |
| A0A835Y177 | 528-611 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.