DPCstruct | MC50566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 108 ± 16 aa |
| Standard deviation of domain lengths | 16.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0HCG5 | 25-133 | LHIFIEHGSIAVTAAHSLSFEYAYTLDIVVTDYAGHSDHLMVPIIAWLKIHQPELLLNRDLCRDGFKFQAELLDNGKSDVEILLKLT… |
| B1HH91 | 25-130 | LLVFVNEGRIEATGTRTASFDYEYECEIIIRDFIGNPDDVMIAVVEWARANQPDLVTNRDERRNGMTFVADILSNNAVDLGLKVKLS… |
| A0A376PMY9 | 14-116 | None |
| A0A2N3DU76 | 58-172 | None |
| G5Q6I4 | 1-96 | None |
| A0A559QNL5 | 316-445 | None |
| A0A378B242 | 1-88 | None |
| A0A2E6BQB2 | 43-175 | None |
| S5MV95 | 25-134 | None |
| A0A0T9KMA3 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.