DPCstruct | MC50564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 87 ± 18 aa |
| Standard deviation of domain lengths | 17.96 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A560JJD2 | 1-87 | MDGFNLTAWPHGPQLRRNQPLPSLSLYVPAGWQHGDQWAPEELKLGMRLHNLLPSVSEPKKSLTLRDVNYTASIGPPGSEDEIFLRR |
| A0A109K005 | 5-68 | ELYLPQGWEHGEQWASEDFKKGMRLHGVLPDEVRPETRLTIRGLDYIASIGPPGLEHEVFLRRA |
| A0A844T3L1 | 15-77 | None |
| A0A1I3JUU3 | 37-129 | None |
| A0A7Y4GXT4 | 32-107 | None |
| A0A1B1UKM8 | 460-550 | None |
| A0A6P1B6S4 | 6-106 | None |
| A0A4Y3ZYK8 | 217-324 | None |
| A0A3A5K1R4 | 388-475 | None |
| A0A562K866 | 96-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.