DPCstruct | MC50551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 247 ± 30 aa |
| Standard deviation of domain lengths | 29.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T5BUA6 | 7-231 | KFYFNIEFVQPDYEVQREMRDPQSYWYPPTDPNGVSVVATTGWRKWDAGSITQAHVPGGINVQECSLFYDSERDIFLGVPFNCKKTS… |
| A0A178B3Y5 | 2-179 | TTTSGHWLPSTIRDYNYRCGGGVSGAYGFCDRERIRLLPPSSVHPQSLEHFKTFSVFYCAGFGFWVLEGDATAPHPDSAWRPLRFDF… |
| A0A842ZK22 | 45-327 | None |
| A0A6A6PV49 | 26-264 | None |
| A0A2T3B8Y6 | 1-259 | None |
| A0A6A7BCI7 | 276-537 | None |
| A0A6A6U1D3 | 1-230 | None |
| A0A428UE58 | 669-934 | None |
| A0A098DMG7 | 3-229 | None |
| A0A4Z0YPN7 | 2-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.