DPCstruct | MC5055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 340 ± 41 aa |
| Standard deviation of domain lengths | 41.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.37 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0125- PF09373 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H4VB28 | 269-572 | PSVTIDELLYASYSVQSYIEANHELPANVTIAEKTITMSQFLQLINTAAINLNTNITTSLPLGNYTSALNPSETISTTGNLTKTDYL… |
| A0A7L4NZC7 | 342-676 | DVCTESSTTTVSVSQVASAASSVKSFIESNQRLPNYVTISGEQVTMSEFLYLLTTGTIQVNSGSTTAITVKNVDSATNSTENVESGN… |
| A0A843AD13 | 44-388 | None |
| A0A843AM16 | 13-415 | None |
| A0A2A2H3J4 | 236-563 | None |
| A0A347AFG1 | 67-438 | None |
| A0A347AFG2 | 58-393 | None |
| U6ECM8 | 79-407 | None |
| K2QAW8 | 2-307 | None |
| A0A3A5HNN7 | 405-760 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.