DPCstruct | MC50548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 217 ± 20 aa |
| Standard deviation of domain lengths | 19.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.50 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | CL0770- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T5BGW7 | 10-213 | IWDNFPVNDSKHDCLFLNPLTGRAAVLYKYLLGFTFNMMIEPYPSLPTLTNYANYMWNEPAYNADESMAAILQELSGDNKQVHEALV… |
| A0A415RBL4 | 1-226 | MWWNYPVNDYMESKLALGPVTDLPRGGNIPAIFFNPMKYEALSKIALATGAAYARDPQNYDPERAWQQAIAEQYAPLHEDMARFADH… |
| A0A1B1ZTI3 | 56-298 | None |
| A0A1H5PZG6 | 425-653 | None |
| A0A836W1Q7 | 172-342 | None |
| A0A6M0L4G7 | 150-382 | None |
| A0A1H4KKF5 | 327-539 | None |
| A0A7C4DHE9 | 530-766 | None |
| A0A651EEG3 | 426-621 | None |
| A0A7C6Z7I7 | 342-543 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.