DPCstruct | MC50541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 102 ± 7 aa |
| Standard deviation of domain lengths | 6.90 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N7WFL9 | 114-212 | HETKLPAFVRLLSQQISYAKAADRLGVDYTAIANWTAKFRAWFRELDPTCEWERRVRLGLKPRALGACPNCTAQALRFYGFASESGD… |
| A0A4R0WLN6 | 1-117 | MLRKDILYGFLPLLSQHRPLAYAADELGTTPEIVKAWVRRSREWLLLMDPTGDFERRVRLGLKAPRPLMDCPHRLKQAEARPHGFKR… |
| A0A419TZL9 | 184-279 | None |
| A0A7W8URN7 | 11-111 | None |
| A0A127Q6Z6 | 227-328 | None |
| C4IA00 | 27-119 | None |
| A0A1H3NL57 | 321-420 | None |
| A0A4R0WQ66 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.