DPCstruct | MC5054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 152 ± 22 aa |
| Standard deviation of domain lengths | 21.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09373 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L4NXC1 | 1-145 | MSVDEVGYGSSAVKNYTETHSNKIPSYVKVNGKNSTAPSFLNTLTKTVVQVNQNVETPVTISSVGAAPNPSGSATGNLSKSEYITIA… |
| A0A419JRD7 | 205-344 | MDEALSRAFSIDEVVHLASDLETISFKKVDKLYVSASEVFWLVTAALASYRVHGALPSKIENMQPLGPYRSFKSERLATVKLNEFLD… |
| A0A1H7NNJ4 | 646-788 | None |
| A0A366M7T1 | 71-224 | None |
| A0A347AFG1 | 110-215 | None |
| A0A7C6Q571 | 2-130 | None |
| A0A843FQY3 | 264-412 | None |
| U6ECM8 | 208-363 | None |
| A0A2A2H886 | 23-166 | None |
| A0A347AFG2 | 177-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.