DPCstruct | MC50539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 150 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Standard deviation of domain lengths | 9.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L8W9Q4 | 2-76 | KYACPCCSYLTFDEMPAGSFDICPVCYWEDDPVQSKDPNFVGGANGVSLIEAKANFLKFGAVKKECQRYVRQPLP |
| A0A2A8TEJ8 | 1-52 | MKYTCPCCGYKTLDEEPPGTYDICEICFWEDDGYQYEHPDEDGANYVSFREA |
| A0A7X9KZF4 | 6-72 | None |
| A0A4Y9T3W6 | 78-151 | None |
| A0A1M3E1B0 | 4-75 | None |
| A0A413S633 | 8-69 | None |
| A0A6G8FX20 | 71-142 | None |
| A0A5J6SN01 | 2-68 | None |
| A0A433DH09 | 3-82 | None |
| A0A3B9IXN8 | 62-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.