DPCstruct | MC5053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4TKS5 | 135-212 | MIKAHDMVADQAAAEYNVTWTRTTPIVVSIFDDAYSTVLTLECDHRFGMDVVGDPSSVWAFRYACSAAINPIEHWVME |
| A0A7L4NWZ3 | 3-80 | MIYCHDILANTAAGEFNVTWTRTHPAVVSVGDDAYQTYLTLECDHSMGMTVIGSLKNMILFNSACSSRISTIEYGIMN |
| A0A1V4TD87 | 122-217 | None |
| A0A2I0PIQ0 | 3-76 | None |
| A0A2H4VGK9 | 11-84 | None |
| R7PXT2 | 72-162 | None |
| A5UK78 | 72-168 | None |
| A0A1V4Z8U8 | 738-828 | None |
| A0A1V4TEX5 | 1-91 | None |
| A0A089ZUX6 | 4-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.