DPCstruct | MC50529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 79 ± 14 aa |
| Standard deviation of domain lengths | 14.26 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8ARJ9 | 1-77 | MRKSRFSIEEIMDILKEGETGEISISSVCRKYDISNVTYYQWRRKYNGFTIPEAKRIKVLEEENNRLKKLLAERDLE |
| A0A415BJM9 | 1-88 | MKKSIHSESEMVKAVKELESGISAEVVARGHGVTRVTLYNWKSKYSGMDVNQVRRLKELEEENRKLKQMYADLALDNRILRDVIKKNS |
| A0A839YTG3 | 1-91 | None |
| A0A5H2Y3P6 | 1-105 | None |
| A0A6M1LVE2 | 1-63 | None |
| A0A4P5NR77 | 1-99 | None |
| A0A2N5C382 | 26-115 | None |
| A0A811GQJ3 | 1-63 | None |
| A0A3R7T409 | 161-249 | None |
| A0A502MQE1 | 6-53 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.