DPCstruct | MC50524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 581 |
|---|---|
| Mean domain length (aa) | 202 ± 41 aa |
| Standard deviation of domain lengths | 41.21 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 11.17 |
| Pfam Score | 50.92 |
| Assigned Pfam label(s) | CL0395- CL0361- PF20236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225AWN3 | 25-214 | SARDTQESQVPSPYPPQSYHMQAPLRTLKAEYTKWTLTGLRVYDATTSENLYEAKIKWMKSSMAFTKPGSTDPFATVKFHTFTPRWD… |
| A0A2R6NP81 | 2-126 | SIATLTLTPDNPINTTITSSTGDVLYNVVTEYTRKSTFTQVRNQNDEVIGSLEWRDILADRVRIGDQKPMSMWDWMKKSVVPFKDQA… |
| A0A3B6N0E0 | 2-156 | None |
| A0A285CLF0 | 78-238 | None |
| A0A0D3GNV6 | 35-216 | None |
| G0RRD3 | 23-268 | None |
| M9LIX7 | 131-411 | None |
| A0A7S4RL65 | 248-436 | None |
| A0A4Y7JSW9 | 11-183 | None |
| A0A1D2N1G0 | 61-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.