DPCstruct | MC5052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 68 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1P8WU53 | 2-57 | FVGRDTAGHWLVQGCKGQLEGRFISQGAAWAFARSECRGVPGAIALAALHPLVPAI |
| A0A3D9YYZ0 | 1-70 | MSSEDQRAAAPNSLHFVVGRDTEAHWIVVETHGLCGGLFRDQAAALHYAEEECQAQAGDLEIACEPIRLI |
| F8J8I8 | 58-116 | None |
| A0A6G8TZ85 | 1-72 | None |
| A5EH95 | 28-106 | None |
| A0A2T4ZGX1 | 2-66 | None |
| A0A1N6IB76 | 73-145 | None |
| Q216I6 | 4-76 | None |
| A0A1M7CDG1 | 47-130 | None |
| A0A0J6VXT9 | 2-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.