DPCstruct | MC50519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 177 |
|---|---|
| Mean domain length (aa) | 316 ± 75 aa |
| Standard deviation of domain lengths | 74.53 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.86 |
| Pfam Score | 99.49 |
| Assigned Pfam label(s) | CL0023- PF05183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7P7D8 | 50-368 | VPVDYIVHAIEKMSCFKKTCLDPVNWMSNQYLKYEQSDCPPKSPRISLDDGLVYVHRVQITPSKVYFCGPEVNVSNRVLRHFSDEMI… |
| A0A0V8QBZ8 | 137-378 | STPTTKKTQYELPDGFNYVEDKEGNYVYETKTIGVIYSRKELRDYLYEHGFNCNGNHYIRLKRTSGSARVGKCLFVEESLYPKMHEW… |
| A0A820YT59 | 247-604 | None |
| K3WPH3 | 11-293 | None |
| I1CD10 | 580-916 | None |
| G2YY25 | 390-703 | None |
| A0A813V344 | 3-200 | None |
| A0A2I1EA53 | 125-485 | None |
| A0A146HU95 | 9-298 | None |
| B8I8S4 | 74-536 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.