DPCstruct | MC50516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 78 ± 4 aa |
| Standard deviation of domain lengths | 3.93 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 43.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13891 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1A0W3 | 374-450 | LQKVEGKIKLCSFESCKMNSVLLSDYCFSHILFDKNQKLFSECTYQMPNGKKCRYPILKIQLPTLCREHLDIYETNN |
| A0A5P1E723 | 71-142 | EEEENEEGERKRCGTSGCKSKAMPLTTYCHQHILSDKKQTLYKGCAFATKSSQPKCGKPILRSTVPSLCHVH |
| A0A7J7N315 | 62-139 | None |
| A0A0K9NTI5 | 124-205 | None |
| A0A834GG04 | 94-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.