DPCstruct | MC50512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 162 ± 30 aa |
| Standard deviation of domain lengths | 30.21 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.97 |
| Pfam Score | 99.37 |
| Assigned Pfam label(s) | PF02773- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7NNX1 | 14-164 | YKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGSAQPFKGARISGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIA… |
| A0A6A5NV92 | 8-113 | TTSGREYKVKDLSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAILIETQTSLSAEVCWCSCNIFSTQDH… |
| U1WTS9 | 67-220 | None |
| A0A0C2J6C7 | 2-125 | None |
| A0A2X2T5H4 | 4-107 | None |
| A0A485NEP0 | 7-141 | None |
| A0A383WA04 | 15-122 | None |
| A0A6N9YDF4 | 2-121 | None |
| A0A818VQW3 | 95-273 | None |
| A0A0C2ME08 | 7-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.