DPCstruct | MC5051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 167 ± 15 aa |
| Standard deviation of domain lengths | 14.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 29.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A564WEG5 | 1-160 | MPQFDPSVWSPQIIWLIVSFVALYYIMSRFVLPRLNEILEEREFRISDSLRRAENLKEEAEQAVAAYEQTMADARAKAQAQVQSSHE… |
| A0A3D9YYC4 | 4-178 | GTAQTTASQAQPAQQQFPPFDTTNFASLLIWLALTFGLLYWLMSRIALPRVAGILEARHHKINTDVLAAHAKRKEADQAATDYQKTL… |
| A0A1V5LCU0 | 1-161 | None |
| A0A3D3IT77 | 3-221 | None |
| A0A7C3C1L4 | 2-146 | None |
| A0A2S6TG74 | 1-136 | None |
| A0A1I3WCY6 | 191-364 | None |
| A0A501XEP0 | 1-158 | None |
| A0A1R1IM31 | 3-174 | None |
| A0A2E6X9N1 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.