DPCstruct | MC50509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Standard deviation of domain lengths | 7.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M8FZG2 | 5-67 | PEQIARRDIDLALQKSGWVVQNYKAIDFTLGKGIAICEYPTDSGPADYILFVDKIPIGIIETN |
| A0A6I3QLB7 | 1-67 | MTPEQKARISIDKKLEQSGWMVQDVKRLNPMASLGVAVREFPTDTGPVDYALFVNGIPVGVIEAKKS |
| W6K020 | 3-72 | None |
| A0A4S5CVL9 | 25-83 | None |
| A0A7W1HF26 | 2-63 | None |
| A0A2V6CHK8 | 2-81 | None |
| A0A522FUR4 | 2-78 | None |
| A0A1K1Q0G3 | 1-59 | None |
| A0A844BES5 | 4-68 | None |
| A0A7W0H1V8 | 18-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.