DPCstruct | MC5050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 187 ± 12 aa |
| Standard deviation of domain lengths | 11.97 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 27.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0YEI8 | 134-308 | WGNSIHLLSISTDPAMAAFVLRSLRPAIPLLAPLPKLRDRFFKLVLDLFGSSDAVPVRVQAFLSIRGLATALPQPALTLALKGFYRA… |
| A0A1D6JPC5 | 5-194 | LANALHMITEMTDEQMIAFIVHRVRASAVFLTAFPSLPRKYVKALLHTWARGRGAMPLVSFMFLRDLCIQVGSNCLDTCLKGIYKAY… |
| A0A0B2UJ37 | 51-254 | None |
| X6MUK9 | 3-200 | None |
| A0A438G868 | 291-460 | None |
| A0A2P2KEM3 | 89-270 | None |
| A0A1B0F9N3 | 88-264 | None |
| A0A4W3GI65 | 111-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.