DPCstruct | MC50498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Standard deviation of domain lengths | 7.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 55.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4I5I8 | 613-727 | PTRYTGFVRSLVDTWRHDGYLPEARSSNFNGRVQGGSNADNVLADAYVKGVTHPNLNWTDAFLAMQTDAEQVPVNNNDKMASDSSTK… |
| A0A1E1M5H5 | 41-143 | VISPVAYDEYLRAMIDMLRFDGYMPDGRSSNHNSRTHGGTNVDNVSADACVKNFRGQVNLSDRYAAMVKDAEITPPNTNYPDLMALD… |
| A0A1V6PDA2 | 41-139 | None |
| A0A162YBZ7 | 719-816 | None |
| A0A842Z7I3 | 1-117 | None |
| A0A218YUH5 | 2-105 | None |
| A0A6G1NME7 | 327-440 | None |
| V5GCY0 | 709-805 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.