DPCstruct | MC50496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 186 ± 17 aa |
| Standard deviation of domain lengths | 17.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 38.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6G3D9 | 1-196 | MFLGHCALHPIMAEWPKIGMPPPAFFQHVRKLEISLTPEFPVEIICANFDLPGLKHRHDAWDFHWLRLDSFKSLQSLKIWISTRTIM… |
| A0A4R8RIM0 | 182-371 | FFGRCARPQPGTERIMPPAFLKHSRSLELSLNPDFPALLPCVDLDIPGIPRHHDVYDFHWLRIDQCPNLQSLKVWIASRSIIWASLL… |
| A0A094GBB3 | 1-172 | None |
| L2GFG2 | 33-227 | None |
| A0A2B7X1W4 | 179-367 | None |
| A0A395MKL4 | 298-520 | None |
| C7ZI00 | 381-562 | None |
| A0A3M2SKG7 | 278-447 | None |
| A0A094B281 | 416-605 | None |
| X0H795 | 187-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.