DPCstruct | MC5049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 66 ± 14 aa |
| Standard deviation of domain lengths | 13.74 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5ZX21 | 125-181 | MKSLSKAAEIRGHSFWARGPDNAGSYNSAPHETGFFRDGGDYDSYYGRFFLNWYSQV |
| A0A1D6JNC6 | 1-74 | MLSSLKAAAEAVGKPEWGNAGPGDSGSYKDWPEDTGFFRREGGWSTEYGEFFMSWYSQVEREAEGVAHATQPLV |
| A0A7I8K1R5 | 155-208 | None |
| A0A4D9A0B9 | 21-98 | None |
| A0A2P6P9C5 | 325-378 | None |
| A0A2P6P9F2 | 1-55 | None |
| D8UF66 | 184-237 | None |
| A0A5N5HN96 | 240-321 | None |
| C1E347 | 143-197 | None |
| A0A0B0MNQ4 | 54-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.