DPCstruct | MC50489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 165 ± 16 aa |
| Standard deviation of domain lengths | 15.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.84 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A828ZSH8 | 1-193 | RQEEQKAKEAEKKRQEEQKAKEAEKKRQEEINQKTSTAKTILEQAEANPTRDNYNAALSAIQSIPGGNQELLNRLVNVDSTIKSNEA… |
| A0A7G7IRA8 | 97-275 | EEQKAKEAEKKRQEEQKAKEAEKKRQEEINQKTSTAKTILEQAEANPTRDNYNAALSAIQSIPGGNQELLNRLVNVDSTIKSNEAAE… |
| R2PPD1 | 5-156 | None |
| A0A1T4QL47 | 188-335 | None |
| A0A511H331 | 188-345 | None |
| A0A5E9H314 | 165-342 | None |
| A0A0R2J9X1 | 123-297 | None |
| A0A854KG78 | 109-255 | None |
| F4BSK2 | 242-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.