DPCstruct | MC50487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 127 ± 17 aa |
| Standard deviation of domain lengths | 17.11 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3CUY9 | 12-130 | GGAMRDDVKQFNLGFISHKVLNIEQARIEFIQALENLLSIINSDKEIKPFLHDYPFEAKNIYLSLVFKKTNGKYVDQPHIAYVFLNT… |
| A0A2A4YB55 | 37-179 | MITIPYIKDMCKSHNLDPFGGGGGFLGGVNLIIISFASDDQVGITQARNLLIECSEDLLQRMNSDEQIKPYLEHYPFSEKGIELSIN… |
| A0A7W1JMC4 | 38-183 | None |
| A0A6M1ZX31 | 46-193 | None |
| A0A7X5QA56 | 3-112 | None |
| A0A7X5Q6G9 | 36-171 | None |
| A0A838NC42 | 19-147 | None |
| A0A2E3LVU7 | 34-165 | None |
| A0A7X5Q4L9 | 1-98 | None |
| A0A090D225 | 270-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.